Recombinant Full Length Human Glycerol-3-Phosphate Acyltransferase 3(Agpat9) Protein, His-Tagged
Cat.No. : | RFL18115HF |
Product Overview : | Recombinant Full Length Human Glycerol-3-phosphate acyltransferase 3(AGPAT9) Protein (Q53EU6) (1-434aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-434) |
Form : | Lyophilized powder |
AA Sequence : | MEGAELAGKILSTWLTLVLGFILLPSVFGVSLGISEIYMKILVKTLEWATIRIEKGTPKE SILKNSASVGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEE LVSWNLLTRTNVNFQYISLRLTMVWVLGVIVRYCVLLPLRVTLAFIGISLLVIGTTLVGQ LPDSSLKNWLSELVHLTCCRICVRALSGTIHYHNKQYRPQKGGICVANHTSPIDVLILTT DGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEMKDRHLVTKRLKEHIADKKKLPILI FPEGTCINNTSVMMFKKGSFEIGGTIHPVAIKYNPQFGDAFWNSSKYNMVSYLLRMMTSW AIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQ KNYSKMIVGNGSLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPAT3 |
Synonyms | GPAT3; AGPAT9; MAG1; HMFN0839; UNQ2753/PRO6492; Glycerol-3-phosphate acyltransferase 3; GPAT-3; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 10; AGPAT 10; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 9; 1-AGP acyltransferase 9; 1-AGPAT 9; Acyl-CoA |
UniProt ID | Q53EU6 |
◆ Recombinant Proteins | ||
SETMAR-5350R | Recombinant Rat SETMAR Protein | +Inquiry |
GTF2A1-11933Z | Recombinant Zebrafish GTF2A1 | +Inquiry |
Mapk1-482MAF488 | Recombinant Mouse Mapk1 Protein, Gly/Pro-tagged, Alexa Fluor 488 conjugated | +Inquiry |
RFL27658OF | Recombinant Full Length Oryza Sativa Subsp. Japonica Photosystem I Assembly Protein Ycf4(Ycf4) Protein, His-Tagged | +Inquiry |
C1qtnf3-4855M | Recombinant Mouse C1qtnf3 protein, His&Myc-tagged | +Inquiry |
◆ Native Proteins | ||
Tropomyosin-894R | Native Rabbit Tropomyosin Protein | +Inquiry |
LTA-14S | Native S. aureus LTA Protein | +Inquiry |
Crp-5382R | Native Rat C-Reactive Protein, Petaxin Related | +Inquiry |
GPT-187H | Active Native Human Glutamate Pyruvate Transaminase | +Inquiry |
Factor Xa-64H | Native Human Factor Xa | +Inquiry |
◆ Cell & Tissue Lysates | ||
CES5A-7563HCL | Recombinant Human CES7 293 Cell Lysate | +Inquiry |
KLHL4-944HCL | Recombinant Human KLHL4 cell lysate | +Inquiry |
Cerebellum-64R | Rhesus monkey Cerebellum (LT) Lysate | +Inquiry |
LCN2-2781MCL | Recombinant Mouse LCN2 cell lysate | +Inquiry |
DNAJC10-6880HCL | Recombinant Human DNAJC10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPAT3 Products
Required fields are marked with *
My Review for All GPAT3 Products
Required fields are marked with *
0
Inquiry Basket