Recombinant Full Length Human GFPT2 Protein, C-Flag-tagged
Cat.No. : | GFPT2-1604HFL |
Product Overview : | Recombinant Full Length Human GFPT2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable glutamine-fructose-6-phosphate transaminase (isomerizing) activity. Predicted to be involved in UDP-N-acetylglucosamine metabolic process; fructose 6-phosphate metabolic process; and protein N-linked glycosylation. Predicted to act upstream of or within cellular response to leukemia inhibitory factor. Predicted to be located in cytosol. Implicated in type 2 diabetes mellitus. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 76.8 kDa |
AA Sequence : | MCGIFAYMNYRVPRTRKEIFETLIKGLQRLEYRGYDSAGVAIDGNNHEVKERHIQLVKKRGKVKALDEEL YKQDSMDLKVEFETHFGIAHTRWATHGVPSAVNSHPQRSDKGNEFVVIHNGIITNYKDLRKFLESKGYEF ESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEGAFALVFKSVHYPGEAVATRRGSPLLIGVRS KYKLSTEQIPILYRTCTLENVKNICKTRMKRLDSSACLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDD DIAAVADGKLSIHRVKRSASDDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETN TVLLGGLKDHLKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFF ISQSGETADTLLALRYCKDRGALTVGVTNTVGSSISRETDCGVHINAGPEVGVASTKAYTSQFISLVMFG LMMSEDRISLQNRRQEIIRGLRSLPELIKEVLSLEEKIHDLALELYTQRSLLVMGRGYNYATCLEGALKI KEITYMHSEGILAGELKHGPLALIDKQMPVIMVIMKDPCFAKCQNALQQVTARQGRPIILCSKDDTESSK FAYKTIELPHTVDCLQGILSVIPLQLLSFHLAVLRGYDVDFPRNLAKSVTVETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Protease |
Protein Pathways : | Alanine, aspartate and glutamate metabolism, Amino sugar and nucleotide sugar metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | GFPT2 glutamine-fructose-6-phosphate transaminase 2 [ Homo sapiens (human) ] |
Official Symbol | GFPT2 |
Synonyms | GFAT; GFAT2; GFAT 2 |
Gene ID | 9945 |
mRNA Refseq | NM_005110.4 |
Protein Refseq | NP_005101.1 |
MIM | 603865 |
UniProt ID | O94808 |
◆ Recombinant Proteins | ||
GFPT2-3430Z | Recombinant Zebrafish GFPT2 | +Inquiry |
GFPT2-4859H | Recombinant Human GFPT2 Protein, GST-tagged | +Inquiry |
GFPT2-4890H | Recombinant Human GFPT2 Protein, Myc/DDK-tagged | +Inquiry |
GFPT2-2169R | Recombinant Rat GFPT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GFPT2-13234H | Recombinant Human GFPT2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GFPT2-5952HCL | Recombinant Human GFPT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GFPT2 Products
Required fields are marked with *
My Review for All GFPT2 Products
Required fields are marked with *
0
Inquiry Basket