Recombinant Full Length Human GFOD2 Protein, GST-tagged

• Cat.No.: GFOD2-5428HF
• Product Overview: Human GFOD2 full-length ORF ( AAH00757.1, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 280 amino acids
• Description: GFOD2 (Glucose-Fructose Oxidoreductase Domain Containing 2) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity. An important paralog of this gene is GFOD1.
• Molecular Mass: 57.3 kDa
• AA Sequence: MVTASRYYPQLMSLVGNVLRFLPAFVRMKQLISEHYVGAVMICDARIYSGSLLSPSYGWICDELMGGGGLHTMGTYIVDLLTHLTGRRAEKVHGLLKTFVRQNAAIRGIRHVTSDDFCFFQMLMGGGVCSTVTLNFNMPGAFVHEVMVVGSAGRLVARGADLYGQKNSATQEELLLRDSLAVGAGLPEQGPQDVPLLYLKGMVYMVQALRQSFQGQGDRRTWDRTPVSMAASFEDGLYMQSVVDAIKRSSRSGEWEAVEVLTEEPDTNQNLCEALQRNNL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GFOD2 glucose-fructose oxidoreductase domain containing 2 [ Homo sapiens ]
• Official Symbol: GFOD2
• Synonyms: GFOD2; glucose-fructose oxidoreductase domain containing 2; glucose-fructose oxidoreductase domain-containing protein 2; FLJ23802; MGC11335; FLJ39316
• Gene ID: 81577
• mRNA Refseq: NM_001243650
• Protein Refseq: NP_001230579
• MIM: 619933
• UniProt ID: Q3B7J2