Recombinant Full Length Human GDPD3 Protein, GST-tagged

• Cat.No.: GDPD3-5275HF
• Product Overview: Human GDPD3 full-length ORF ( NP_077283.1, 1 a.a. - 256 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 256 amino acids
• Description: GDPD3 (Glycerophosphodiester Phosphodiesterase Domain Containing 3) is a Protein Coding gene. Among its related pathways are PI Metabolism and Metabolism. GO annotations related to this gene include phosphoric diester hydrolase activity and glycerophosphodiester phosphodiesterase activity. An important paralog of this gene is GDPD1.
• Molecular Mass: 56 kDa
• AA Sequence: MAQRSDLLELDCQLTRDRVVVVSHDENLCRQSGLNRDVGSLDFEDLPLYKEKLEVYFSPGHFAHGSDRRMVRLEDLFQRFPRTPMSVEIKGKNEELIREIAGLVRRYDRNEITIWASEKSSVMKKCKAANPEMPLSFTISRGFWVLLSYYLGLLPFIPIPEKFFFCFLPNIINRTYFPFSCSCLNQLLAVVSKWLIMRKSLIRHLEERGVQVVFWCLNEESDFEAAFSVGATGVITDYPTALRHYLDNHGPAARTS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GDPD3 glycerophosphodiester phosphodiesterase domain containing 3 [ Homo sapiens ]
• Official Symbol: GDPD3
• Synonyms: GDPD3; glycerophosphodiester phosphodiesterase domain containing 3; glycerophosphodiester phosphodiesterase domain-containing protein 3; MGC4171; FLJ22603
• Gene ID: 79153
• mRNA Refseq: NM_024307
• Protein Refseq: NP_077283
• MIM: 616318
• UniProt ID: Q7L5L3