Recombinant Full Length Human GATC Protein, GST-tagged

• Cat.No.: GATC-5478HF
• Product Overview: Human GATC full-length ORF ( NP_789788.1, 1 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 136 amino acids
• Description: GATC (Glutamyl-TRNA Amidotransferase Subunit C) is a Protein Coding gene. Among its related pathways are Metabolism and tRNA Aminoacylation. GO annotations related to this gene include glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity. An important paralog of this gene is ENSG00000111780.
• Molecular Mass: 41.5 kDa
• AA Sequence: MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GATC glutamyl-tRNA amidotransferase subunit C [ Homo sapiens (human) ]
• Official Symbol: GATC
• Synonyms: GATC; glutamyl-tRNA amidotransferase subunit C; 15E1.2; glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial; glu-AdT subunit C; glutamyl-tRNA(Gln) amidotransferase, subunit C homolog; EC 6.3.5.-
• Gene ID: 283459
• mRNA Refseq: NM_176818
• Protein Refseq: NP_789788
• MIM: 617210
• UniProt ID: O43716