Recombinant Full Length Human GATAD1 Protein, GST-tagged

• Cat.No.: GATAD1-5472HF
• Product Overview: Human GATAD1 full-length ORF ( NP_066990.3, 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene contains a zinc finger at the N-terminus, and is thought to bind to a histone modification site that regulates gene expression. Mutations in this gene have been associated with autosomal recessive dilated cardiomyopathy. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jun 2012]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 55.1 kDa
• Protein length: 269 amino acids
• AA Sequence: MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGRGGAGSGGAGSGAAGGTGGSGGGGFGAATFASTSATPPQSNGGGGGKQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRRHIFKLKNPIKAPESVSTIITAESIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALTWLIPTLSSPRDQFDPASYIIGPEEDLPRKMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKESVANHL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GATAD1 GATA zinc finger domain containing 1 [ Homo sapiens ]
• Official Symbol: GATAD1
• Synonyms: GATAD1; GATA zinc finger domain containing 1; GATA zinc finger domain-containing protein 1; FLJ22489; ocular development associated gene; ODAG; RG083M05.2; ocular development associated; ocular development-associated gene protein; FLJ40695
• Gene ID: 57798
• mRNA Refseq: NM_021167
• Protein Refseq: NP_066990
• MIM: 614518
• UniProt ID: Q8WUU5