Recombinant Full Length Human GATAD1 Protein, GST-tagged

Cat.No. : GATAD1-5472HF
Product Overview : Human GATAD1 full-length ORF ( NP_066990.3, 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 269 amino acids
Description : The protein encoded by this gene contains a zinc finger at the N-terminus, and is thought to bind to a histone modification site that regulates gene expression. Mutations in this gene have been associated with autosomal recessive dilated cardiomyopathy. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jun 2012]
Molecular Mass : 55.1 kDa
AA Sequence : MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGRGGAGSGGAGSGAAGGTGGSGGGGFGAATFASTSATPPQSNGGGGGKQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRRHIFKLKNPIKAPESVSTIITAESIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALTWLIPTLSSPRDQFDPASYIIGPEEDLPRKMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKESVANHL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GATAD1 GATA zinc finger domain containing 1 [ Homo sapiens ]
Official Symbol GATAD1
Synonyms GATAD1; GATA zinc finger domain containing 1; GATA zinc finger domain-containing protein 1; FLJ22489; ocular development associated gene; ODAG; RG083M05.2; ocular development associated; ocular development-associated gene protein; FLJ40695;
Gene ID 57798
mRNA Refseq NM_021167
Protein Refseq NP_066990
MIM 614518
UniProt ID Q8WUU5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GATAD1 Products

Required fields are marked with *

My Review for All GATAD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon