Recombinant Full Length Human GABARAP Protein, GST-tagged

Cat.No. : GABARAP-5148HF
Product Overview : Human GABARAP full-length ORF ( NP_009209.1, 1 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 117 amino acids
Description : Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. This gene encodes GABA(A) receptor-associated protein, which is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton. [provided by RefSeq
Molecular Mass : 40.3 kDa
AA Sequence : MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GABARAP GABA(A) receptor-associated protein [ Homo sapiens ]
Official Symbol GABARAP
Synonyms GABARAP; GABA(A) receptor-associated protein; gamma-aminobutyric acid receptor-associated protein; ATG8A; MM46; GABARAP-a; FLJ25768; MGC120154; MGC120155;
Gene ID 11337
mRNA Refseq NM_007278
Protein Refseq NP_009209
MIM 605125
UniProt ID O95166

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GABARAP Products

Required fields are marked with *

My Review for All GABARAP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon