Recombinant Full Length Human FUNDC1 Protein, GST-tagged

• Cat.No.: FUNDC1-5137HF
• Product Overview: Human FUNDC1 full-length ORF ( NP_776155.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein with a FUN14 superfamily domain. The function of the encoded protein is not known. [provided by RefSeq, Sep 2011]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 43.6 kDa
• Protein length: 155 amino acids
• AA Sequence: MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FUNDC1 FUN14 domain containing 1 [ Homo sapiens ]
• Official Symbol: FUNDC1
• Synonyms: FUNDC1; FUN14 domain containing 1; FUN14 domain-containing protein 1; MGC51029
• Gene ID: 139341
• mRNA Refseq: NM_173794
• Protein Refseq: NP_776155
• MIM: 300871
• UniProt ID: Q8IVP5