Recombinant Full Length Human FUNDC1 Protein, GST-tagged
Cat.No. : | FUNDC1-5137HF |
Product Overview : | Human FUNDC1 full-length ORF ( NP_776155.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a protein with a FUN14 superfamily domain. The function of the encoded protein is not known. [provided by RefSeq, Sep 2011] |
Source : | In Vitro Cell Free System |
Species : | Human |
Tag : | GST |
Molecular Mass : | 43.6 kDa |
Protein length : | 155 amino acids |
AA Sequence : | MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FUNDC1 FUN14 domain containing 1 [ Homo sapiens ] |
Official Symbol | FUNDC1 |
Synonyms | FUNDC1; FUN14 domain containing 1; FUN14 domain-containing protein 1; MGC51029; |
Gene ID | 139341 |
mRNA Refseq | NM_173794 |
Protein Refseq | NP_776155 |
MIM | 300871 |
UniProt ID | Q8IVP5 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All FUNDC1 Products
Required fields are marked with *
My Review for All FUNDC1 Products
Required fields are marked with *
0
Inquiry Basket