Recombinant Full Length Human FSCN3 Protein, GST-tagged

• Cat.No.: FSCN3-5080HF
• Product Overview: Human FSCN3 full-length ORF ( NP_065102.1, 1 a.a. - 498 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FSCN3 (Fascin Actin-Bundling Protein 3) is a Protein Coding gene. Diseases associated with FSCN3 include Hodgkin's Lymphoma, Lymphocytic Depletion and Colloid Carcinoma Of The Pancreas. Among its related pathways are MAPK-Erk Pathway. GO annotations related to this gene include actin filament binding and protein binding, bridging. An important paralog of this gene is FSCN1.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 83 kDa
• Protein length: 498 amino acids
• AA Sequence: MDETEWIHRHPKAEDLRVGLISWAGTYLTFEACKNTVTATAKSLGRRQTWEILVSNEHETQAVVRLKSVQGLYLLCECDGTVCYGRPRTSHHGCFLLRFHRNSKWTLQCLISGRYLESNGKDVFCTSHVLSAYHMWTPRPALHVHVILYSPIHRCYARADPTMGRIWVDAAVPCLEECGFLLHFRDGCYHLETSTHHFLSHVDRLFSQPSSQTAFHMQVRPGGLVALCDGEGGMLYPQGTHLLLGMGCNPMRGEEWFILQHCPTWVSLRSKTGRFISVIYDGEVRAASERLNRMSLFQFECDSESPTVQLRSANGYYLSQRRHRAVMADGHPLESDTFFRMHWNCGRIILQSCRGRFLGIAPNSLLMANVILPGPNEEFGILFANRSFLVLRGRYGYVGSSSGHDLIQCNQDQPDRIHLLPCRPGIYHFQAQGGSFWSITSFGTFRPWGKFALNFCIELQGSNLLTVLAPNGFYMRADQSGTLLADSEDITRECIWEF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FSCN3 fascin homolog 3, actin-bundling protein, testicular (Strongylocentrotus purpuratus) [ Homo sapiens ]
• Official Symbol: FSCN3
• Synonyms: FSCN3; fascin homolog 3, actin-bundling protein, testicular (Strongylocentrotus purpuratus); fascin (Strongylocentrotus purpuratus) homolog 3 (actin bundling protein, testicular); fascin-3; testis fascin
• Gene ID: 29999
• mRNA Refseq: NM_020369
• Protein Refseq: NP_065102
• MIM: 615800
• UniProt ID: Q9NQT6