Recombinant Full Length Human FPGT Protein, GST-tagged
Cat.No. : | FPGT-5129HF |
Product Overview : | Human FPGT full-length ORF ( NP_003829.2, 1 a.a. - 594 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 594 amino acids |
Description : | L-fucose is a key sugar in glycoproteins and other complex carbohydrates since it may be involved in many of the functional roles of these macromolecules, such as in cell-cell recognition. The fucosyl donor for these fucosylated oligosaccharides is GDP-beta-L-fucose. There are two alternate pathways for the biosynthesis of GDP-fucose; the major pathway converts GDP-alpha-D-mannose to GDP-beta-L-fucose. The protein encoded by this gene participates in an alternate pathway that is present in certain mammalian tissues, such as liver and kidney, and appears to function as a salvage pathway to reutilize L-fucose arising from the turnover of glycoproteins and glycolipids. This pathway involves the phosphorylation of L-fucose to form beta-L-fucose-1-phosphate, and then condensation of the beta-L-fucose-1-phosphate with GTP by fucose-1-phosphate guanylyltransferase to form GDP-beta-L-fucose. [provided by RefSeq |
Molecular Mass : | 93 kDa |
AA Sequence : | MAAARDPPEVSLREATQRKLRRFSELRGKLVARGEFWDIVAITAADEKQELAYNQQLSEKLKRKELPLGVQYHVFVDPAGAKIGNGGSTLCALQCLEKLYGDKWNSFTILLIHSGGYSQRLPNASALGKIFTALPLGNPIYQMLELKLAMYIDFPLNMNPGILVTCADDIELYSIGEFEFIRFDKPGFTALAHPSSLTIGTTHGVFVLDPFDDLKHRDLEYRSCHRFLHKPSIEKMYQFNAVCRPGNFCQQDFAGGDIADLKLDSDYVYTDSLFYMDHKSAKMLLAFYEKIGTLSCEIDAYGDFLQALGPGATVEYTRNTSNVIKEESELVEMRQRIFHLLKGTSLNVVVLNNSKFYHIGTTEEYLFYFTSDNSLKSELGLQSITFSIFPDIPECSGKTSCIIQSILDSRCSVAPGSVVEYSRLGPDVSVGENCIISGSYILTKAALPAHSFVCSLSLKMNRCLKYATMAFGVQDNLKKSVKTLSDIKLLQFFGVCFLSCLDVWNLKVTEELFSGNKTCLSLWTARIFPVCSSLSDSVITSLKMLNAVKNKSAFSLNSYKLLSIEEMLIYKDVEDMITYREQIFLEISLKSSLM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FPGT fucose-1-phosphate guanylyltransferase [ Homo sapiens ] |
Official Symbol | FPGT |
Synonyms | FPGT; fucose-1-phosphate guanylyltransferase; GFPP; GDP-L-fucose diphosphorylase; GDP-beta-L-fucose pyrophosphorylase; fucose-1-phosphate guanyltransferase; |
Gene ID | 8790 |
mRNA Refseq | NM_001199328 |
Protein Refseq | NP_001186257 |
MIM | 603609 |
UniProt ID | O14772 |
◆ Recombinant Proteins | ||
FPGT-740H | Recombinant Human FPGT Protein, His-tagged | +Inquiry |
FPGT-1749R | Recombinant Rhesus monkey FPGT Protein, His-tagged | +Inquiry |
FPGT-4501C | Recombinant Chicken FPGT | +Inquiry |
FPGT-1396H | Recombinant Human FPGT Protein (1-594 aa), His-tagged | +Inquiry |
Fpgt-741M | Recombinant Mouse Fpgt Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FPGT-6139HCL | Recombinant Human FPGT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FPGT Products
Required fields are marked with *
My Review for All FPGT Products
Required fields are marked with *
0
Inquiry Basket