Recombinant Full Length Human FOXS1 Protein, GST-tagged

• Cat.No.: FOXS1-4825HF
• Product Overview: Human FKHL18 full-length ORF ( NP_004109.1, 1 a.a. - 330 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The forkhead family of transcription factors belongs to the winged helix class of DNA-binding proteins. The protein encoded by this intronless gene contains a forkhead domain and is found predominantly in aorta and kidney. The function of the encoded protein is unknown. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 61.8 kDa
• Protein length: 330 amino acids
• AA Sequence: MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGAEGTRGPAKARRGPLRATSQDPGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPKEISTPKPACPGELPVATSSSSCPAFGFPAGFSEAESFNKAPTPVLSPESGIGSSYQCRLQALNFCMGADPGLEHLLASAAPSPAPPTPPGSLRAPLPLPTDHKEPWVAGGFPVQGGSGYPLGLTPCLYRTPGMFFFE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FOXS1 forkhead box S1 [ Homo sapiens ]
• Official Symbol: FOXS1
• Synonyms: FOXS1; forkhead box S1; FKHL18, forkhead (Drosophila) like 18, forkhead like 18 (Drosophila); forkhead box protein S1; FREAC10; FREAC-10; forkhead-like 18 protein; forkhead-related activator 10; forkhead-related transcription factor 10; forkhead-related transcription factor FREAC-10; FKHL18; MGC4544
• Gene ID: 2307
• mRNA Refseq: NM_004118
• Protein Refseq: NP_004109
• MIM: 602939
• UniProt ID: O43638