Recombinant Full Length Human FOXS1 Protein, GST-tagged
Cat.No. : | FOXS1-4825HF |
Product Overview : | Human FKHL18 full-length ORF ( NP_004109.1, 1 a.a. - 330 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 330 amino acids |
Description : | The forkhead family of transcription factors belongs to the winged helix class of DNA-binding proteins. The protein encoded by this intronless gene contains a forkhead domain and is found predominantly in aorta and kidney. The function of the encoded protein is unknown. [provided by RefSeq |
Molecular Mass : | 61.8 kDa |
AA Sequence : | MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGAEGTRGPAKARRGPLRATSQDPGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPKEISTPKPACPGELPVATSSSSCPAFGFPAGFSEAESFNKAPTPVLSPESGIGSSYQCRLQALNFCMGADPGLEHLLASAAPSPAPPTPPGSLRAPLPLPTDHKEPWVAGGFPVQGGSGYPLGLTPCLYRTPGMFFFE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FOXS1 forkhead box S1 [ Homo sapiens ] |
Official Symbol | FOXS1 |
Synonyms | FOXS1; forkhead box S1; FKHL18, forkhead (Drosophila) like 18, forkhead like 18 (Drosophila); forkhead box protein S1; FREAC10; FREAC-10; forkhead-like 18 protein; forkhead-related activator 10; forkhead-related transcription factor 10; forkhead-related transcription factor FREAC-10; FKHL18; MGC4544; |
Gene ID | 2307 |
mRNA Refseq | NM_004118 |
Protein Refseq | NP_004109 |
MIM | 602939 |
UniProt ID | O43638 |
◆ Recombinant Proteins | ||
FOXS1-2553H | Recombinant Human FOXS1 Protein, MYC/DDK-tagged | +Inquiry |
FOXS1-4202H | Recombinant Human FOXS1 Protein, GST-tagged | +Inquiry |
Foxs1-3082M | Recombinant Mouse Foxs1 Protein, Myc/DDK-tagged | +Inquiry |
FOXS1-1748R | Recombinant Rhesus monkey FOXS1 Protein, His-tagged | +Inquiry |
FOXS1-5399H | Recombinant Human FOXS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXS1-625HCL | Recombinant Human FOXS1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FOXS1 Products
Required fields are marked with *
My Review for All FOXS1 Products
Required fields are marked with *
0
Inquiry Basket