Recombinant Full Length Human FLJ45513 Protein, GST-tagged

Cat.No. : FLJ45513-4937HF
Product Overview : Human FLJ45513 full-length ORF (BAC86972.1, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
ProteinLength : 130 amino acids
Description : FLJ45513 (Uncharacterized LOC729220) is a Protein Coding gene.
Molecular Mass : 40.1 kDa
AA Sequence : MTTGWGSPESKGGEETDVQKEAGISGDTPSPAALSSLHTLPGSDKPERKPTMQDCPCDGSSRGSISKRLRGPHRGPGPQAKATPVSLPSWEWEESGPALSCLPPWKPSLSTGLLFTRLCLWLVGICPLSD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FLJ45513 uncharacterized LOC729220 [ Homo sapiens (human) ]
Official Symbol FLJ45513
Synonyms FLJ45513; uncharacterized LOC729220; uncharacterized protein LOC729220; Uncharacterized LOC729220; RP11-304F15.3
Gene ID 729220
mRNA Refseq NM_001242791
Protein Refseq NP_001229720

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FLJ45513 Products

Required fields are marked with *

My Review for All FLJ45513 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon