Recombinant Full Length Human FLJ45513 Protein, GST-tagged

• Cat.No.: FLJ45513-4937HF
• Product Overview: Human FLJ45513 full-length ORF (BAC86972.1, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 130 amino acids
• Description: FLJ45513 (Uncharacterized LOC729220) is a Protein Coding gene.
• Molecular Mass: 40.1 kDa
• AA Sequence: MTTGWGSPESKGGEETDVQKEAGISGDTPSPAALSSLHTLPGSDKPERKPTMQDCPCDGSSRGSISKRLRGPHRGPGPQAKATPVSLPSWEWEESGPALSCLPPWKPSLSTGLLFTRLCLWLVGICPLSD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FLJ45513 uncharacterized LOC729220 [ Homo sapiens (human) ]
• Official Symbol: FLJ45513
• Synonyms: FLJ45513; uncharacterized LOC729220; uncharacterized protein LOC729220; Uncharacterized LOC729220; RP11-304F15.3
• Gene ID: 729220
• mRNA Refseq: NM_001242791
• Protein Refseq: NP_001229720