Recombinant Full Length Human FLI1 Protein, C-Flag-tagged
Cat.No. : | FLI1-286HFL |
Product Overview : | Recombinant Full Length Human FLI1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a transcription factor containing an ETS DNA-binding domain. The gene can undergo a t(11;22)(q24;q12) translocation with the Ewing sarcoma gene on chromosome 22, which results in a fusion gene that is present in the majority of Ewing sarcoma cases. An acute lymphoblastic leukemia-associated t(4;11)(q21;q23) translocation involving this gene has also been identified. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 50.8 kDa |
AA Sequence : | MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQPVRVNVKREY DHMNGSRESPVDCSVSKCSKLVGGGESNPMNYNSYMDEKNGPPPPNMTTNERRVIVPADPTLWTQEHVRQ WLEWAIKEYSLMEIDTSFFQNMDGKELCKMNKEDFLRATTLYNTEVLLSHLSYLRESSLLAYNTTSHTDQ SSRLSVKEDPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNTEQRPQPDPYQILGPTSSRLANPGSGQ IQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTK VHGKRYAYKFDFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMPVTSSSFFGAAS QYWTSPTGGIYPNPNVPRHPNTHVPSHLGSYYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | FLI1 Fli-1 proto-oncogene, ETS transcription factor [ Homo sapiens (human) ] |
Official Symbol | FLI1 |
Synonyms | EWSR2; FLI-1; SIC-1; BDPLT21 |
Gene ID | 2313 |
mRNA Refseq | NM_002017.5 |
Protein Refseq | NP_002008.2 |
MIM | 193067 |
UniProt ID | Q01543 |
◆ Recombinant Proteins | ||
FLI1-001H | Recombinant Human Fli-1 proto-oncogene, ETS transcription factor Protein, His-tagged | +Inquiry |
FLI1-3730H | Recombinant Human FLI1 protein, His-tagged | +Inquiry |
FLI1-12924H | Recombinant Human FLI1, GST-tagged | +Inquiry |
FLI1-758H | Recombinant Human FLI1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FLI1-919H | Recombinant Human FLI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLI1-6195HCL | Recombinant Human FLI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FLI1 Products
Required fields are marked with *
My Review for All FLI1 Products
Required fields are marked with *
0
Inquiry Basket