Recombinant Full Length Human FKBP2 Protein, GST-tagged

• Cat.No.: FKBP2-4802HF
• Product Overview: Human FKBP2 full-length ORF ( NP_004461.2, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 42 kDa
• Protein length: 142 amino acids
• AA Sequence: MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FKBP2 FK506 binding protein 2, 13kDa [ Homo sapiens ]
• Official Symbol: FKBP2
• Synonyms: FKBP2; FK506 binding protein 2, 13kDa; FK506 binding protein 2 (13kD); peptidyl-prolyl cis-trans isomerase FKBP2; FKBP 13; peptidyl prolyl cis trans isomerase; PPIase; proline isomerase; rapamycin binding protein; FKBP-2; rotamase; 13 kDa FKBP; PPIase FKBP2; immunophilin FKBP13; rapamycin-binding protein; 13 kDa FK506-binding protein; FK506-binding protein 2 (13kD); FKBP-13
• Gene ID: 2286
• mRNA Refseq: NM_001135208
• Protein Refseq: NP_001128680
• MIM: 186946
• UniProt ID: P26885