Recombinant Full Length Human FGF5 Protein, GST-tagged

• Cat.No.: FGF5-4835HF
• Product Overview: Human FGF5 full-length ORF ( NP_149134.1, 1 a.a. - 123 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 123 amino acids
• Description: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified as an oncogene, which confers transforming potential when transfected into mammalian cells. Targeted disruption of the homolog of this gene in mouse resulted in the phenotype of abnormally long hair, which suggested a function as an inhibitor of hair elongation. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
• Molecular Mass: 39.4 kDa
• AA Sequence: MSLSFLLLLFFSHLILSAWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSQVHR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FGF5 fibroblast growth factor 5 [ Homo sapiens ]
• Official Symbol: FGF5
• Synonyms: FGF5; fibroblast growth factor 5; heparin-binding growth factor 5; HBGF-5; Smag-82
• Gene ID: 2250
• mRNA Refseq: NM_004464
• Protein Refseq: NP_004455
• MIM: 165190
• UniProt ID: P12034