Recombinant Full Length Human FGF21 Protein, GST-tagged

• Cat.No.: FGF21-4822HF
• Product Overview: Human FGF21 full-length ORF ( AAH18404, 30 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 30-209 amino acids
• Description: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined. [provided by RefSeq
• Molecular Mass: 45.54 kDa
• AA Sequence: PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FGF21 fibroblast growth factor 21 [ Homo sapiens ]
• Official Symbol: FGF21
• Synonyms: FGF21; fibroblast growth factor 21; FGF-21
• Gene ID: 26291
• mRNA Refseq: NM_019113
• Protein Refseq: NP_061986
• MIM: 609436
• UniProt ID: Q9NSA1