Recombinant Full Length Human FGF13 Protein
Cat.No. : | FGF13-168HF |
Product Overview : | Recombinant full length Human FGF13 containing an N-terminal proprietary tag; Predicted MW 52.69 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 245 amino acids |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This gene is located in a region on chromosome X, which is associated with Borjeson-Forssman-Lehmann syndrome (BFLS), making it a possible candidate gene for familial cases of the BFLS, and for other syndromal and nonspecific forms of X-linked mental retardation mapping to this region. Alternative splicing of this gene at the 5 end results in several transcript variants encoding different isoforms with different N-termini. |
Form : | Liquid |
Molecular Mass : | 52.690kDa inclusive of tags |
AA Sequence : | MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDK NKLNVFSRVKLFGSKKRRRRRPEPQLKGIATKLYSRQGYH LQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK LYLAMNSEGYLYTSELFTPECKFKESVFENYYVTYSSMIY RQQQSGRGWYLGLNKEGEIMKGDHVKKNKPAAHFLPKPLK VAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMS HNEST |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | FGF13 fibroblast growth factor 13 [ Homo sapiens ] |
Official Symbol | FGF13 |
Synonyms | FGF13; fibroblast growth factor 13; FGF2; FHF2; fibroblast growth factor homologous factor 2 |
Gene ID | 2258 |
mRNA Refseq | NM_001139498 |
Protein Refseq | NP_001132970 |
MIM | 300070 |
UniProt ID | Q92913 |
◆ Recombinant Proteins | ||
FGF13-1695R | Recombinant Rhesus monkey FGF13 Protein, His-tagged | +Inquiry |
FGF13-27598TH | Recombinant Human FGF13 | +Inquiry |
FGF13-5841M | Recombinant Mouse FGF13 Protein | +Inquiry |
FGF13-12863H | Recombinant Human FGF13, GST-tagged | +Inquiry |
FGF13-3228M | Recombinant Mouse FGF13 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF13-6248HCL | Recombinant Human FGF13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF13 Products
Required fields are marked with *
My Review for All FGF13 Products
Required fields are marked with *
0
Inquiry Basket