Recombinant Full Length Human FGF13 Protein

• Cat.No.: FGF13-168HF
• Product Overview: Recombinant full length Human FGF13 containing an N-terminal proprietary tag; Predicted MW 52.69 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 245 amino acids
• Description: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This gene is located in a region on chromosome X, which is associated with Borjeson-Forssman-Lehmann syndrome (BFLS), making it a possible candidate gene for familial cases of the BFLS, and for other syndromal and nonspecific forms of X-linked mental retardation mapping to this region. Alternative splicing of this gene at the 5 end results in several transcript variants encoding different isoforms with different N-termini.
• Form: Liquid
• Molecular Mass: 52.690kDa inclusive of tags
• AA Sequence: MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDK NKLNVFSRVKLFGSKKRRRRRPEPQLKGIATKLYSRQGYH LQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK LYLAMNSEGYLYTSELFTPECKFKESVFENYYVTYSSMIY RQQQSGRGWYLGLNKEGEIMKGDHVKKNKPAAHFLPKPLK VAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMS HNEST
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: FGF13 fibroblast growth factor 13 [ Homo sapiens ]
• Official Symbol: FGF13
• Synonyms: FGF13; fibroblast growth factor 13; FGF2; FHF2; fibroblast growth factor homologous factor 2
• Gene ID: 2258
• mRNA Refseq: NM_001139498
• Protein Refseq: NP_001132970
• MIM: 300070
• UniProt ID: Q92913