Recombinant Full Length Human FGF12 Protein, GST-tagged

• Cat.No.: FGF12-4809HF
• Product Overview: Human FGF12 full-length ORF ( AAH22524, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 45.65 kDa
• Protein length: 181 amino acids
• AA Sequence: MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FGF12 fibroblast growth factor 12 [ Homo sapiens ]
• Official Symbol: FGF12
• Synonyms: FGF12; fibroblast growth factor 12; FGF12B; FHF1; fibroblast growth factor 12B; fibroblast growth factor FGF 12b; fibroblast growth factor homologous factor 1; myocyte activating factor; FHF-1; FGF-12; myocyte-activating factor; fibroblast growth factor FGF-12b
• Gene ID: 2257
• mRNA Refseq: NM_004113
• Protein Refseq: NP_004104
• MIM: 601513
• UniProt ID: P61328