Recombinant Full Length Human FDFT1 Protein, C-Flag-tagged
Cat.No. : | FDFT1-1048HFL |
Product Overview : | Recombinant Full Length Human FDFT1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a membrane-associated enzyme located at a branch point in the mevalonate pathway. The encoded protein is the first specific enzyme in cholesterol biosynthesis, catalyzing the dimerization of two molecules of farnesyl diphosphate in a two-step reaction to form squalene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 47.9 kDa |
AA Sequence : | MEFVKCLGHPEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYRYLNQTSRSFAAVIQALDGEMRNAVC IFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQ TVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLF LQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRL RNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIP DSDPSSSKTRQIISTIRTQNLPNCQLISRSHYSPIYLSFVMLLAALSWQYLTTLSQVTEDYVQTGEHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Steroid biosynthesis |
Full Length : | Full L. |
Gene Name | FDFT1 farnesyl-diphosphate farnesyltransferase 1 [ Homo sapiens (human) ] |
Official Symbol | FDFT1 |
Synonyms | SS; SQS; DGPT; ERG9; SQSD |
Gene ID | 2222 |
mRNA Refseq | NM_004462.5 |
Protein Refseq | NP_004453.3 |
MIM | 184420 |
UniProt ID | P37268 |
◆ Recombinant Proteins | ||
FDFT1-4057H | Recombinant Human FDFT1 Protein, GST-tagged | +Inquiry |
RFL4907BF | Recombinant Full Length Bovine Squalene Synthase(Fdft1) Protein, His-Tagged | +Inquiry |
FDFT1-5803M | Recombinant Mouse FDFT1 Protein | +Inquiry |
FDFT1-2308R | Recombinant Rat FDFT1 Protein | +Inquiry |
FDFT1-904H | Recombinant Human FDFT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FDFT1-6271HCL | Recombinant Human FDFT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FDFT1 Products
Required fields are marked with *
My Review for All FDFT1 Products
Required fields are marked with *
0
Inquiry Basket