Recombinant Full Length Human FBXL15 Protein, GST-tagged

• Cat.No.: FBXL15-4946HF
• Product Overview: Human FBXL15 full-length ORF (1 a.a. - 296 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 296 amino acids
• Description: FBXL15 (F-Box And Leucine Rich Repeat Protein 15) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include ubiquitin-protein transferase activity. An important paralog of this gene is FBXL20.
• Molecular Mass: 58.96 kDa
• AA Sequence: MEPSGGEQEPGAVRFLDLPWEDVLLPHVLNRVPLRQLLRLQRVSRAFRSLVQLHLAGLRRFDAAQVGPQIPRAALARLLRDAEGLQELALAPCHEWLSDEDLVPVLARNPQLRSVALGGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLKDEAIVYLAQRRGAGLRSLSLAVNANVGDAAVQELARNCPELHHLDLTGCLRVGSDGVRTLAEYCPVLRSLRVRHCHHVAESSLSRLRKRGVDIDVEPPLHQALVLLQDMAGFAPFVNLQV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FBXL15 F-box and leucine-rich repeat protein 15 [ Homo sapiens ]
• Official Symbol: FBXL15
• Synonyms: FBXL15; F-box and leucine-rich repeat protein 15; F box only protein 37 , FBXO37; F-box/LRR-repeat protein 15; Fbl15; MGC11279; F-box only protein 37; pleckstrin and Sec7 domain protein; JET; PSD; FBXO37; FLJ16137
• Gene ID: 79176
• mRNA Refseq: NM_024326
• Protein Refseq: NP_077302
• MIM: 610287
• UniProt ID: Q9H469