Recombinant Full Length Human Fatty Acid 2-Hydroxylase(Fa2H) Protein, His-Tagged
Cat.No. : | RFL6729HF |
Product Overview : | Recombinant Full Length Human Fatty acid 2-hydroxylase(FA2H) Protein (Q7L5A8) (1-372aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-372) |
Form : | Lyophilized powder |
AA Sequence : | MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISA DLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWD KDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLV LYLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHM KPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTV FAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGISTKLWDYCFH TLTPEKPHLKTQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FA2H |
Synonyms | FA2H; FAAH; FAXDC1; Fatty acid 2-hydroxylase; Fatty acid alpha-hydroxylase; Fatty acid hydroxylase domain-containing protein 1 |
UniProt ID | Q7L5A8 |
◆ Recombinant Proteins | ||
FUNDC1-2662H | Recombinant Human FUNDC1 Protein, His-tagged | +Inquiry |
ELA3L-3012Z | Recombinant Zebrafish ELA3L | +Inquiry |
GTF2A1-13587H | Recombinant Human GTF2A1, GST-tagged | +Inquiry |
AMY2B-145R | Recombinant Rhesus Macaque AMY2B Protein, His (Fc)-Avi-tagged | +Inquiry |
TECTB-661H | Recombinant Human TECTB Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Troponin-16R | Native Rabbit Skeletal Muscle Troponin ITC Complex | +Inquiry |
CXCL9-30233TH | Native Human CXCL9 | +Inquiry |
Collagen-55B | Native Bovine Collagen Type II | +Inquiry |
IgY-006D | Native Duck IgY | +Inquiry |
Lectin-1854U | Active Native Ulex Europaeus Agglutinin I Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LTA4H-653MCL | Recombinant Mouse LTA4H cell lysate | +Inquiry |
ICOS-2444HCL | Recombinant Human ICOS cell lysate | +Inquiry |
USP50-1897HCL | Recombinant Human USP50 cell lysate | +Inquiry |
CUL2-7184HCL | Recombinant Human CUL2 293 Cell Lysate | +Inquiry |
SLAMF9-1808HCL | Recombinant Human SLAMF9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FA2H Products
Required fields are marked with *
My Review for All FA2H Products
Required fields are marked with *
0
Inquiry Basket