Recombinant Full Length Human FAM3C Protein, GST-tagged

• Cat.No.: FAM3C-4586HF
• Product Overview: Human FAM3C full-length ORF (AAH46932, 25 a.a. - 227 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is a member of the family with sequence similarity 3 (FAM3) family and encodes a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells. [provided by RefSeq, Mar 2010]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 48.07 kDa
• Protein length: 227 amino acids
• AA Sequence: QVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM3C family with sequence similarity 3, member C [ Homo sapiens ]
• Official Symbol: FAM3C
• Synonyms: FAM3C; family with sequence similarity 3, member C; protein FAM3C; GS3876; ILEI; interleukin like EMT inducer; predicted osteoblast protein; interleukin-like EMT inducer; GS3786
• Gene ID: 10447
• mRNA Refseq: NM_001040020
• Protein Refseq: NP_001035109
• MIM: 608618
• UniProt ID: Q92520