Recombinant Full Length Human FAM19A2 Protein, GST-tagged

Cat.No. : FAM19A2-4544HF
Product Overview : Human FAM19A2 full-length ORF (BAG53916.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 131 amino acids
Description : This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. [provided by RefSeq, Jul 2008]
Molecular Mass : 41 kDa
AA Sequence : MSKRYLQKATKGKLLIIIFIVTLWGKVVSSANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM19A2 family with sequence similarity 19 (chemokine (C-C motif)-like), member A2 [ Homo sapiens ]
Official Symbol FAM19A2
Synonyms FAM19A2; family with sequence similarity 19 (chemokine (C-C motif)-like), member A2; protein FAM19A2; TAFA 2; chemokine-like protein TAFA-2; TAFA2; TAFA-2; MGC42403; DKFZp761E1217; DKFZp781P0552;
Gene ID 338811
mRNA Refseq NM_178539
Protein Refseq NP_848634
MIM 617496
UniProt ID Q8N3H0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FAM19A2 Products

Required fields are marked with *

My Review for All FAM19A2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon