Recombinant Full Length Human FAM19A2 Protein, GST-tagged
Cat.No. : | FAM19A2-4544HF |
Product Overview : | Human FAM19A2 full-length ORF (BAG53916.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 131 amino acids |
Description : | This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 41 kDa |
AA Sequence : | MSKRYLQKATKGKLLIIIFIVTLWGKVVSSANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM19A2 family with sequence similarity 19 (chemokine (C-C motif)-like), member A2 [ Homo sapiens ] |
Official Symbol | FAM19A2 |
Synonyms | FAM19A2; family with sequence similarity 19 (chemokine (C-C motif)-like), member A2; protein FAM19A2; TAFA 2; chemokine-like protein TAFA-2; TAFA2; TAFA-2; MGC42403; DKFZp761E1217; DKFZp781P0552; |
Gene ID | 338811 |
mRNA Refseq | NM_178539 |
Protein Refseq | NP_848634 |
MIM | 617496 |
UniProt ID | Q8N3H0 |
◆ Recombinant Proteins | ||
FAM19A2-7311H | Recombinant Human FAM19A2 protein, hFc-tagged | +Inquiry |
FAM19A2-319H | Active Recombinant Human FAM19A2 | +Inquiry |
Fam19a2-1565M | Recombinant Mouse Fam19a2 protein, His & T7-tagged | +Inquiry |
FAM19A2-3731H | Recombinant Human FAM19A2 Protein, GST-tagged | +Inquiry |
FAM19A2-971H | Recombinant Human FAM19A2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM19A2-1465HCL | Recombinant Human FAM19A2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM19A2 Products
Required fields are marked with *
My Review for All FAM19A2 Products
Required fields are marked with *
0
Inquiry Basket