Recombinant Full Length Human FAIM2 Protein, GST-tagged

• Cat.No.: FAIM2-4443HF
• Product Overview: Human FAIM2 full-length ORF ( AAH00051, 1 a.a. - 316 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FAIM2 (Fas Apoptotic Inhibitory Molecule 2) is a Protein Coding gene. Among its related pathways are Dimerization of procaspase-8. An important paralog of this gene is TMBIM1.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 60.5 kDa
• Protein length: 316 amino acids
• AA Sequence: MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLMGNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAIM2 Fas apoptotic inhibitory molecule 2 [ Homo sapiens ]
• Official Symbol: FAIM2
• Synonyms: FAIM2; Fas apoptotic inhibitory molecule 2; protein lifeguard 2; KIAA0950; LFG; LFG2; LIFEGUARD; NMP35; TMBIM2; transmembrane BAX inhibitor motif containing 2; neural membrane protein 35; transmembrane BAX inhibitor motif-containing protein 2; NGP35
• Gene ID: 23017
• mRNA Refseq: NM_012306
• Protein Refseq: NP_036438
• MIM: 604306
• UniProt ID: Q9BWQ8