Recombinant Full Length Human ERP29 Protein, C-Flag-tagged
Cat.No. : | ERP29-1492HFL |
Product Overview : | Recombinant Full Length Human ERP29 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein which localizes to the lumen of the endoplasmic reticulum (ER). It is a member of the protein disulfide isomerase (PDI) protein family but lacks an active thioredoxin motif, suggesting that this protein does not function as a disulfide isomerase. The canonical protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 25.8 kDa |
AA Sequence : | MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQ DEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGA IQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKIL DQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | ERP29 endoplasmic reticulum protein 29 [ Homo sapiens (human) ] |
Official Symbol | ERP29 |
Synonyms | ERp28; ERp31; PDIA9; PDI-DB; C12orf8; HEL-S-107 |
Gene ID | 10961 |
mRNA Refseq | NM_006817.4 |
Protein Refseq | NP_006808.1 |
MIM | 602287 |
UniProt ID | P30040 |
◆ Recombinant Proteins | ||
Erp29-702M | Recombinant Mouse Erp29 Protein, His-tagged | +Inquiry |
ERP29-1497R | Recombinant Rhesus monkey ERP29 Protein, His-tagged | +Inquiry |
ERP29-1215H | Recombinant Human ERP29 Protein (40-251 aa), GST-tagged | +Inquiry |
ERP29-1732H | Recombinant Human ERP29 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ERP29-2860M | Recombinant Mouse ERP29 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERP29-6544HCL | Recombinant Human ERP29 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERP29 Products
Required fields are marked with *
My Review for All ERP29 Products
Required fields are marked with *
0
Inquiry Basket