Recombinant Full Length Human ERICH6 Protein, GST-tagged
Cat.No. : | ERICH6-3838HF |
Product Overview : | Human C3orf44 full-length ORF ( AAH29577.1, 1 a.a. - 517 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
ProteinLength : | 517 amino acids |
Description : | ERICH6 (Glutamate Rich 6) is a Protein Coding gene. An important paralog of this gene is ERICH6B. |
Molecular Mass : | 85 kDa |
AA Sequence : | MSEMSIDRNIHRNLSPGIPVSVQTEESWLQDLSDKVQSRKKASKEKAEPECLASKLREKWVINPEESKLNILYELEFKEDFITLFEPSLRTLPSIGPPSILAYKEESSNLGINFKDEEEETSPKCEFCGSDLRAFFSNVDVSSEPKGHASCCIAFQNLIDYIYEEQIKTKPPKAELIAIDPHAAHGSEVDRLKAKEKALQRKQEQRMARHFAIISREQTHFSEDDSKRLKTISYQLSVDIPEKQIIDDIVFDFQLRNSNMSIICCDSRIACGKVVRNELLEKHYKHGSKFLTSFPDGTTQIFYPSGNLAIIRVPNKVNGFTCIVQEDMPTNPAILAVLDSSGRSSCYHPNGNVWVYINILGGQYSDQAGNRIRAWNWSNSITSSPFVSFKPVFLALNRYIGVRILEQDKISITFLAMGQQARISVGTKVKLPNPEEIPILRYVSGDDLLLLASLIKIRRLFHKLEGCVNFPSSQVWEKLKQPSYLSSLSLKLIALCHSSGIKQDIMKTIRNIINEEI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ERICH6 glutamate rich 6 [ Homo sapiens (human) ] |
Official Symbol | ERICH6 |
Synonyms | ERICH6; glutamate rich 6; C3orf44; ERICH6A; FAM194A; glutamate-rich protein 6; family with sequence similarity 194, member A; glutamate-rich 6A; protein FAM194A; Glutamate Rich 6; Family With Sequence Similarity 194, Member A; Glutamate-Rich 6A; Protein FAM194A; Chromosome 3 Open Reading Frame 44; Glutamate-Rich Protein 6; Glutamate-Rich 6; ERICH6A |
Gene ID | 131831 |
mRNA Refseq | NM_001308234 |
Protein Refseq | NP_001295163 |
UniProt ID | Q7L0X2 |
◆ Recombinant Proteins | ||
SAP014A-018-1853S | Recombinant Staphylococcus aureus (strain: CDC58, other: HA-MRSA) SAP014A_018 protein, His-tagged | +Inquiry |
BAIAP2L1-1807HF | Recombinant Full Length Human BAIAP2L1 Protein, GST-tagged | +Inquiry |
AVR2-3788C | Recombinant Chicken AVR2, His-tagged | +Inquiry |
TDRKH-9114M | Recombinant Mouse TDRKH Protein, His (Fc)-Avi-tagged | +Inquiry |
CD36-3084H | Recombinant Human CD36 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
CAT-1187B | Native Bovine Catalase | +Inquiry |
Lectin-1765D | Active Native Datura Stramonium Lectin Protein, Agarose bound | +Inquiry |
Immunoglobulin A-76H | Native Human Immunoglobulin A | +Inquiry |
Lectin-1743N | Active Native Narcissus Pseudonarcissus (Daffodil) Lectin Protein | +Inquiry |
ALB-108C | Native Cynomolgus Monkey Albumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
LDB1-4792HCL | Recombinant Human LDB1 293 Cell Lysate | +Inquiry |
HGFA-2940HCL | Recombinant Human HGFA cell lysate | +Inquiry |
SCT-2019HCL | Recombinant Human SCT 293 Cell Lysate | +Inquiry |
KIF16B-4954HCL | Recombinant Human KIF16B 293 Cell Lysate | +Inquiry |
DEDD-6996HCL | Recombinant Human DEDD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERICH6 Products
Required fields are marked with *
My Review for All ERICH6 Products
Required fields are marked with *
0
Inquiry Basket