Recombinant Full Length Human ERICH6 Protein, GST-tagged

Cat.No. : ERICH6-3838HF
Product Overview : Human C3orf44 full-length ORF ( AAH29577.1, 1 a.a. - 517 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
ProteinLength : 517 amino acids
Description : ERICH6 (Glutamate Rich 6) is a Protein Coding gene. An important paralog of this gene is ERICH6B.
Molecular Mass : 85 kDa
AA Sequence : MSEMSIDRNIHRNLSPGIPVSVQTEESWLQDLSDKVQSRKKASKEKAEPECLASKLREKWVINPEESKLNILYELEFKEDFITLFEPSLRTLPSIGPPSILAYKEESSNLGINFKDEEEETSPKCEFCGSDLRAFFSNVDVSSEPKGHASCCIAFQNLIDYIYEEQIKTKPPKAELIAIDPHAAHGSEVDRLKAKEKALQRKQEQRMARHFAIISREQTHFSEDDSKRLKTISYQLSVDIPEKQIIDDIVFDFQLRNSNMSIICCDSRIACGKVVRNELLEKHYKHGSKFLTSFPDGTTQIFYPSGNLAIIRVPNKVNGFTCIVQEDMPTNPAILAVLDSSGRSSCYHPNGNVWVYINILGGQYSDQAGNRIRAWNWSNSITSSPFVSFKPVFLALNRYIGVRILEQDKISITFLAMGQQARISVGTKVKLPNPEEIPILRYVSGDDLLLLASLIKIRRLFHKLEGCVNFPSSQVWEKLKQPSYLSSLSLKLIALCHSSGIKQDIMKTIRNIINEEI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ERICH6 glutamate rich 6 [ Homo sapiens (human) ]
Official Symbol ERICH6
Synonyms ERICH6; glutamate rich 6; C3orf44; ERICH6A; FAM194A; glutamate-rich protein 6; family with sequence similarity 194, member A; glutamate-rich 6A; protein FAM194A; Glutamate Rich 6; Family With Sequence Similarity 194, Member A; Glutamate-Rich 6A; Protein FAM194A; Chromosome 3 Open Reading Frame 44; Glutamate-Rich Protein 6; Glutamate-Rich 6; ERICH6A
Gene ID 131831
mRNA Refseq NM_001308234
Protein Refseq NP_001295163
UniProt ID Q7L0X2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ERICH6 Products

Required fields are marked with *

My Review for All ERICH6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon