Recombinant Full Length Human ENOX1 Protein, C-Flag-tagged
Cat.No. : | ENOX1-1025HFL |
Product Overview : | Recombinant Full Length Human ENOX1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is involved in plasma membrane electron transport pathways. The encoded protein has both a hydroquinone (NADH) oxidase activity and a protein disulfide-thiol interchange activity. The two activities cycle with a periodicity of 24 minutes, with one activity being at its peak when the other is at its lowest. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 73.2 kDa |
AA Sequence : | MVDAGGVENITQLPQELPQMMAAAADGLGSIAIDTTQLNMSVTDPTAWATAMNNLGMVPVGLPGQQLVSD SICVPGFDPSLNMMTGITPINPMIPGLGLVPPPPPTEVAVVKEIIHCKSCTLFPQNPNLPPPSTRERPPG CKTVFVGGLPENATEEIIQEVFEQCGDITAIRKSKKNFCHIRFAEEFMVDKAIYLSGYRMRLGSSTDKKD SGRLHVDFAQARDDFYEWECKQRMRAREERHRRKLEEDRLRPPSPPAIMHYSEHEAALLAEKLKDDSKFS EAITVLLSWIERGEVNRRSANQFYSMVQSANSHVRRLMNEKATHEQEMEEAKENFKNALTGILTQFEQIV AVFNASTRQKAWDHFSKAQRKNIDIWRKHSEELRNAQSEQLMGIRREEEMEMSDDENCDSPTKKMRVDES ALAAQAYALKEENDSLRWQLDAYRNEVELLKQEKEQLFRTEENLTKDQQLQFLQQTMQGMQQQLLTIQEE LNNKKSELEQAKEEQSHTQALLKVLQEQLKGTKELVETNGHSHEDSNEINVLTVALVNQDRENNIEKRSQ GLKSEKEALLIGIISTFLHVHPFGANIEYLWSYMQQLDSKISANEIEMLLMRLPRMFKQEFTGVGATLEK RWKLCAFEGIKTTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | ENOX1 ecto-NOX disulfide-thiol exchanger 1 [ Homo sapiens (human) ] |
Official Symbol | ENOX1 |
Synonyms | CNOX; PIG38; cCNOX; bA64J21.1 |
Gene ID | 55068 |
mRNA Refseq | NM_001127615.3 |
Protein Refseq | NP_001121087.1 |
MIM | 610914 |
UniProt ID | Q8TC92 |
◆ Recombinant Proteins | ||
ENOX1-3664H | Recombinant Human ENOX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ENOX1-28568TH | Recombinant Human ENOX1, His-tagged | +Inquiry |
ENOX1-2333H | Recombinant Human ENOX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ENOX1-3770H | Recombinant Human ENOX1 protein, His-tagged | +Inquiry |
ENOX1-5208M | Recombinant Mouse ENOX1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENOX1-6596HCL | Recombinant Human ENOX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ENOX1 Products
Required fields are marked with *
My Review for All ENOX1 Products
Required fields are marked with *
0
Inquiry Basket