Recombinant Full Length Human EMX1 Protein, GST-tagged

• Cat.No.: EMX1-4280HF
• Product Overview: Human EMX1 full-length ORF (AAH45762.2, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: EMX1 (Empty Spiracles Homeobox 1) is a Protein Coding gene. Diseases associated with EMX1 include Kallmann Syndrome. GO annotations related to this gene include sequence-specific DNA binding. An important paralog of this gene is EMX2.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 54.67 kDa
• Protein length: 257 amino acids
• AA Sequence: MFQPAAKRGFTIESLVAKDGGTGGGTGGGGAGSHLLAAAASEEPLRPTALNYPHPSAAEAAFVSGFPAAAAAGAGRSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSLSLSETQVKVWFQNRRTKYKRQKLEEEGPESEQKKKGSHHINRWRIATKQANGEDIDVTSND
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EMX1 empty spiracles homeobox 1 [ Homo sapiens ]
• Official Symbol: EMX1
• Synonyms: EMX1; empty spiracles homeobox 1; empty spiracles homolog 1 (Drosophila); homeobox protein EMX1; empty spiracles homolog 1; empty spiracles-like protein 1
• Gene ID: 2016
• mRNA Refseq: NM_004097
• Protein Refseq: NP_004088
• MIM: 600034
• UniProt ID: Q04741