Recombinant Full Length Human EMCN Protein, GST-tagged

• Cat.No.: EMCN-4232HF
• Product Overview: Human EMCN full-length ORF (BAG36284.1, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: EMCN is a mucin-like sialoglycoprotein that interferes with the assembly of focal adhesion complexes and inhibits interaction between cells and the extracellular matrix (Kinoshita et al., 2001 [PubMed 11418125]).[supplied by OMIM, Mar 2008]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 55.11 kDa
• Protein length: 261 amino acids
• AA Sequence: MELLQVTILFLLPSICSSNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGSVLQPDASPSKTGTLTSIPVTIPENTSQSQVIGTEGGKNASTSATSRSYSSIILPVVIALIVITLSVFVLVGLYRMCWKADPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKTKN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EMCN endomucin [ Homo sapiens ]
• Official Symbol: EMCN
• Synonyms: EMCN; endomucin; MUC14; MUC-14; mucin-14; endomucin-2; gastric cancer antigen Ga34; EMCN2
• Gene ID: 51705
• mRNA Refseq: NM_001159694
• Protein Refseq: NP_001153166
• MIM: 608350
• UniProt ID: Q9ULC0