Recombinant Full Length Human ELAVL3 Protein, C-Flag-tagged
Cat.No. : | ELAVL3-2154HFL |
Product Overview : | Recombinant Full Length Human ELAVL3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | A member of the ELAVL protein family, ELAV-like 3 is a neural-specific RNA-binding protein which contains three RNP-type RNA recognition motifs. The observation that ELAVL3 is one of several Hu antigens (neuronal-specific RNA-binding proteins) recognized by the anti-Hu serum antibody present in sera from patients with paraneoplastic encephalomyelitis and sensory neuronopathy (PEM/PSN) suggests it has a role in neurogenesis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39.4 kDa |
AA Sequence : | MVTQILGAMESQVGGGPAGPALPNGPLLGTNGATDDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKL VRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKE MEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFANNPSQKT GQALLTHLYQSSARRYAGPLHHQTQRFRLDNLLNMAYGVKSPLSLIARFSPIAIDGMSGLAGVGLSGGAA GAGWCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRL GERVLQVSFKTSKQHKA myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | ELAVL3 ELAV like RNA binding protein 3 [ Homo sapiens (human) ] |
Official Symbol | ELAVL3 |
Synonyms | HUC; HUCL; PLE21 |
Gene ID | 1995 |
mRNA Refseq | NM_001420.4 |
Protein Refseq | NP_001411.2 |
MIM | 603458 |
UniProt ID | Q14576 |
◆ Recombinant Proteins | ||
ELAVL3-2732M | Recombinant Mouse ELAVL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELAVL3-4985H | Recombinant Human ELAVL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ELAVL3-4338HF | Recombinant Full Length Human ELAVL3 Protein, GST-tagged | +Inquiry |
ELAVL3-9017Z | Recombinant Zebrafish ELAVL3 | +Inquiry |
ELAVL3-3233H | Recombinant Human ELAVL3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELAVL3-6636HCL | Recombinant Human ELAVL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ELAVL3 Products
Required fields are marked with *
My Review for All ELAVL3 Products
Required fields are marked with *
0
Inquiry Basket