Recombinant Full Length Human EIF5 Protein, GST-tagged
Cat.No. : | EIF5-6913HF |
Product Overview : | Recombinant Human full-length EIF5(1 a.a. - 431 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 431 amino acids |
Description : | Eukaryotic translation initiation factor-5 (EIF5) interacts with the 40S initiation complex to promote hydrolysis of bound GTP with concomitant joining of the 60S ribosomal subunit to the 40S initiation complex. The resulting functional 80S ribosomal initiation complex is then active in peptidyl transfer and chain elongations (summary by Si et al., 1996 [PubMed 8663286]). |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 73.15 kDa |
AA Sequence : | MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYI VNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSD SGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKV LTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHF LRFCHNNKKAKRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASKKYVSKELAKEIRVKA EPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSDNKDDDIDIDAI |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | EIF5 eukaryotic translation initiation factor 5 [ Homo sapiens ] |
Official Symbol | EIF5 |
Synonyms | EIF5; eukaryotic translation initiation factor 5; eIF-5; EIF-5A; |
Gene ID | 1983 |
mRNA Refseq | NM_001969 |
Protein Refseq | NP_001960 |
MIM | 601710 |
UniProt ID | P55010 |
◆ Recombinant Proteins | ||
EIF5-27177TH | Recombinant Human EIF5 protein, GST-tagged | +Inquiry |
EIF5-1627C | Recombinant Chicken EIF5 | +Inquiry |
EIF5-2069R | Recombinant Rat EIF5 Protein | +Inquiry |
EIF5-9994Z | Recombinant Zebrafish EIF5 | +Inquiry |
EIF5-1726R | Recombinant Rat EIF5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF5-6642HCL | Recombinant Human EIF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF5 Products
Required fields are marked with *
My Review for All EIF5 Products
Required fields are marked with *
0
Inquiry Basket