Recombinant Full Length Human EIF4A3 Protein, C-Flag-tagged
Cat.No. : | EIF4A3-848HFL |
Product Overview : | Recombinant Full Length Human EIF4A3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a nuclear matrix protein. Its amino acid sequence is highly similar to the amino acid sequences of the translation initiation factors eIF4AI and eIF4AII, two other members of the DEAD box protein family. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46.7 kDa |
AA Sequence : | MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIK QIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHAC IGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPP ATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQA VIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLII NYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Spliceosome |
Full Length : | Full L. |
Gene Name | EIF4A3 eukaryotic translation initiation factor 4A3 [ Homo sapiens (human) ] |
Official Symbol | EIF4A3 |
Synonyms | Fal1; RCPS; DDX48; MUK34; NUK34; NMP265; eIF4AIII; eIF4A-III; eIF-4A-III |
Gene ID | 9775 |
mRNA Refseq | NM_014740.4 |
Protein Refseq | NP_055555.1 |
MIM | 608546 |
UniProt ID | P38919 |
◆ Recombinant Proteins | ||
EIF4A3-2747H | Recombinant Human EIF4A3 protein(241-410 aa), C-His-tagged | +Inquiry |
EIF4A3-27410TH | Recombinant Human EIF4A3, His-tagged | +Inquiry |
EIF4A3-1334H | Recombinant Human Eukaryotic Translation Initiation Factor 4A3, His-tagged | +Inquiry |
EIF4A3-827H | Recombinant Human EIF4A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF4A3-1722R | Recombinant Rat EIF4A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF4A3-6652HCL | Recombinant Human EIF4A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF4A3 Products
Required fields are marked with *
My Review for All EIF4A3 Products
Required fields are marked with *
0
Inquiry Basket