Recombinant Full Length Human EIF1AX Protein, GST-tagged

Cat.No. : EIF1AX-4402HF
Product Overview : Human EIF1AX full-length ORF ( AAH00793, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes an essential eukaryotic translation initiation factor. The protein is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA. [provided by RefSeq, Jul 2008]
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 41.58 kDa
Protein length : 144 amino acids
AA Sequence : MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EIF1AX eukaryotic translation initiation factor 1A, X chromosome [ Homo sapiens ]
Official Symbol EIF1AX
Synonyms EIF1AX; eukaryotic translation initiation factor 1A, X chromosome; EIF1A; EIF4C;
Gene ID 1964
mRNA Refseq NM_001412
Protein Refseq NP_001403
MIM 300186
UniProt ID P47813

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EIF1AX Products

Required fields are marked with *

My Review for All EIF1AX Products

Required fields are marked with *

0

Inquiry Basket

cartIcon