Recombinant Full Length Human EFEMP2 Protein, GST-tagged

• Cat.No.: EFEMP2-4184HF
• Product Overview: Human EFEMP2 full-length ORF (no protein_acc, 1 a.a. - 229 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Description: A large number of extracellular matrix proteins have been found to contain variations of the epidermal growth factor (EGF) domain and have been implicated in functions as diverse as blood coagulation, activation of complement and determination of cell fate during development. The protein encoded by this gene contains four EGF2 domains and six calcium-binding EGF2 domains. This gene is necessary for elastic fiber formation and connective tissue development. Defects in this gene are cause of an autosomal recessive cutis laxa syndrome. Alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Jan 2011]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 52 kDa
• Protein length: 229 amino acids
• AA Sequence: MGAPCEQRCFNSYGTFLCRCHQGYELHRDGFSCSDIDECSYSSYLCQYRCVNEPGRFSCHCPQGYQLLATRLCQDIDECESGAHQCSEAQTCVNFHGGYRCVDTNRCVEPYIQVSENRCLCPASNPLCREQPSSIVHRYMTITSERSVPADVFQIQATSVYPGAYNAFQIRAGPRPAGDGPPGVRAGPGDGHHEFPHELPGQLCTEAHRLCRGLHLLRSRREPPSLHLP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EFEMP2 EGF containing fibulin-like extracellular matrix protein 2 [ Homo sapiens ]
• Official Symbol: EFEMP2
• Synonyms: EFEMP2; EGF containing fibulin-like extracellular matrix protein 2; EGF containing fibulin like extracellular matrix protein 2; EGF-containing fibulin-like extracellular matrix protein 2; FBLN4; fibulin 4; UPH1; FIBL-4; fibulin-4; mutant p53 binding protein 1; MBP1; ARCL1B
• Gene ID: 30008
• mRNA Refseq: NM_016938
• Protein Refseq: NP_058634
• MIM: 604633
• UniProt ID: O95967