Recombinant Full Length Human EDIL3 Protein, C-Flag-tagged
Cat.No. : | EDIL3-2187HFL |
Product Overview : | Recombinant Full Length Human EDIL3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 53.6 kDa |
AA Sequence : | MKRSVAVWLLVGLSLSVPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEE EPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVAN YSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAEN DRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTP YANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFT WEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWT VYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | EDIL3 EGF like repeats and discoidin domains 3 [ Homo sapiens (human) ] |
Official Symbol | EDIL3 |
Synonyms | DEL1 |
Gene ID | 10085 |
mRNA Refseq | NM_005711.5 |
Protein Refseq | NP_005702.3 |
MIM | 606018 |
UniProt ID | O43854 |
◆ Recombinant Proteins | ||
EDIL3-802H | Recombinant Human EDIL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
EDIL3-2471H | Recombinant Human EDIL3 protein(321-470 aa), N-SUMO & C-His-tagged | +Inquiry |
EDIL3-3053H | Recombinant Human EDIL3 Protein, GST-tagged | +Inquiry |
EDIL3-2639M | Recombinant Mouse EDIL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
EDIL3-001H | Recombinant Human EDIL3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDIL3-6722HCL | Recombinant Human EDIL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EDIL3 Products
Required fields are marked with *
My Review for All EDIL3 Products
Required fields are marked with *
0
Inquiry Basket