Recombinant Full Length Human DYNLT3 Protein, GST-tagged

Cat.No. : DYNLT3-4168HF
Product Overview : Human DYNLT3 full-length ORF ( ACT64502.1, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 116 amino acids
Description : This gene encodes a member of a subclass of dynein light chains. The encoded protein homodimerizes and forms the light chain component of the cytoplasmic dynein motor protein complex. This protein may be important for binding dynein to specific cargos including the spindle checkpoint protein BUB3. This protein may also function independently of dynein as a transcriptional modulator. Pseudogenes of this gene are found on chromosomes 2 and 20.[provided by RefSeq, Mar 2010]
Molecular Mass : 12.8 kDa
AA Sequence : MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DYNLT3 dynein light chain Tctex-type 3 [ Homo sapiens (human) ]
Official Symbol DYNLT3
Synonyms DYNLT3; dynein light chain Tctex-type 3; Dynein Light Chain Tctex-Type 3; Protein 91/23; TCTE1L; T-Complex-Associated-Testis-Expressed 1-Like; T-Complex-Associated Testis-Expressed 1-Like; TCTEX1L; TCTE1XL; RP3; dynein light chain Tctex-type 3; protein 91/23
Gene ID 6990
mRNA Refseq NM_006520
Protein Refseq NP_006511
MIM 300302
UniProt ID P51808

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DYNLT3 Products

Required fields are marked with *

My Review for All DYNLT3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon