Recombinant Full Length Human DYNLL1 Protein, GST-tagged

• Cat.No.: DYNLL1-4155HF
• Product Overview: Human DYNLL1 full-length ORF ( NP_003737.1, 1 a.a. - 89 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 89 amino acids
• Description: Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008]
• Molecular Mass: 36.8 kDa
• AA Sequence: MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DYNLL1 dynein, light chain, LC8-type 1 [ Homo sapiens ]
• Official Symbol: DYNLL1
• Synonyms: DYNLL1; dynein, light chain, LC8-type 1; DNCL1, dynein, cytoplasmic, light polypeptide 1; dynein light chain 1, cytoplasmic; DLC1; DLC8; hdlc1; LC8; PIN; 8 kDa dynein light chain; cytoplasmic dynein light polypeptide; dynein, cytoplasmic, light polypeptide 1; protein inhibitor of neuronal nitric oxide synthase; LC8a; DNCL1; DNCLC1; MGC126137; MGC126138
• Gene ID: 8655
• mRNA Refseq: NM_001037494
• Protein Refseq: NP_001032583
• MIM: 601562
• UniProt ID: P63167