Recombinant Full Length Human DOLPP1 Protein, GST-tagged

• Cat.No.: DOLPP1-3949HF
• Product Overview: Human DOLPP1 full-length ORF ( NP_065171.2, 1 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: A similar gene has been characterized in mice and encodes dolichyl pyrophosphate (Dol-P-P) phosphatase. This protein dephosphorylates dolichyl pyrophosphate so that it may be re-utilized as a glycosyl carrier lipid by the oligosaccharyltransferase multisubunit complex in the ER. Alternative splicing results in multiple transcript variants and protein isoforms. [provided by RefSeq, Jun 2012]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 53.4 kDa
• Protein length: 238 amino acids
• AA Sequence: MAADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLIIFKRELHTISFLGGLALNEGVNWLIKNVIQEPRPCGGPHTAVGTKYGMPSSHSQFMWFFSVYSFLFLYLRMHQTNNARFLDLLWRHVLSLGLLAVAFLVSYSRVYLLYHTWSQVLYGGIAGGLMAIAWFIFTQEVLTPLFPRIAAWPVSEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DOLPP1 dolichyl pyrophosphate phosphatase 1 [ Homo sapiens ]
• Official Symbol: DOLPP1
• Synonyms: DOLPP1; dolichyl pyrophosphate phosphatase 1; dolichyldiphosphatase 1; linked to Surfeit genes in Fugu rubripes 2; LSFR2
• Gene ID: 57171
• mRNA Refseq: NM_001135917
• Protein Refseq: NP_001129389
• MIM: 614516
• UniProt ID: Q86YN1