Recombinant Full Length Human DNAJC5B Protein, GST-tagged
Cat.No. : | DNAJC5B-4021HF |
Product Overview : | Human DNAJC5B full-length ORF ( NP_149096.2, 1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 199 amino acids |
Description : | This gene encodes a member of the DNAJ heat shock protein 40 family of co-chaperone proteins that is characterized by an N-terminal DNAJ domain, a linker region, and a cysteine-rich C-terminal domain. The encoded protein, together with heat shock protein 70, is thought to regulate the proper folding of other proteins. The orthologous mouse protein is membrane-associated and is targeted to the trans-golgi network. [provided by RefSeq, Mar 2017] |
Molecular Mass : | 48.9 kDa |
AA Sequence : | MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEKFKEINNAHAILTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLLTGCYFCCCLCCCCNCCCGHCRPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTNANEKTQLIKEGSRSYCTDS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DNAJC5B DnaJ (Hsp40) homolog, subfamily C, member 5 beta [ Homo sapiens ] |
Official Symbol | DNAJC5B |
Synonyms | DNAJC5B; DnaJ (Hsp40) homolog, subfamily C, member 5 beta; dnaJ homolog subfamily C member 5B; CSP beta; MGC26226; beta-CSP; beta cysteine string protein; cysteine string protein beta; dnaJ homolog subfamily C member X; CSP-beta; |
Gene ID | 85479 |
mRNA Refseq | NM_033105 |
Protein Refseq | NP_149096 |
MIM | 613945 |
UniProt ID | Q9UF47 |
◆ Recombinant Proteins | ||
DNAJC5B-2764H | Recombinant Human DNAJC5B Protein, GST-tagged | +Inquiry |
DNAJC5B-1573R | Recombinant Rat DNAJC5B Protein, His (Fc)-Avi-tagged | +Inquiry |
DNAJC5B-2456M | Recombinant Mouse DNAJC5B Protein, His (Fc)-Avi-tagged | +Inquiry |
DNAJC5B-4717M | Recombinant Mouse DNAJC5B Protein | +Inquiry |
Dnajc5b-2611M | Recombinant Mouse Dnajc5b Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAJC5B-498HCL | Recombinant Human DNAJC5B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNAJC5B Products
Required fields are marked with *
My Review for All DNAJC5B Products
Required fields are marked with *
0
Inquiry Basket