Recombinant Full Length Human DNAJC4 Protein, GST-tagged

Cat.No. : DNAJC4-4019HF
Product Overview : Human DNAJC4 full-length ORF (AAH44584.1, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 241 amino acids
Description : DNAJC4 (DnaJ Heat Shock Protein Family (Hsp40) Member C4) is a Protein Coding gene. GO annotations related to this gene include unfolded protein binding.
Molecular Mass : 52.91 kDa
AA Sequence : MPPLLPLRLCRLWPRNPPSRLLGAAAGQRSRPSTYYELLGVHPGASTEEVKRAFFSKSKELHPDRDPGNPSLHSRFVELSEAYRVLSREQSRRSYDDQLRSGSPPKSPRTTVHDKSAHQTHSSWTPPNAQYWSQFHSVRPQGPQLRQQQHKQNKQVLGYCLLLMLAGMGLHYIAFRKVKQMHLNFMDEKDRIITAFYNEARARARANRGILQQERQRLGQRQPPPSEPTQGPEIVPRGAGP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DNAJC4 DnaJ (Hsp40) homolog, subfamily C, member 4 [ Homo sapiens ]
Official Symbol DNAJC4
Synonyms DNAJC4; DnaJ (Hsp40) homolog, subfamily C, member 4; HSPF2; MCG18; DANJC4
Gene ID 3338
mRNA Refseq NM_005528
Protein Refseq NP_005519
MIM 604189
UniProt ID Q9NNZ3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DNAJC4 Products

Required fields are marked with *

My Review for All DNAJC4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon