Recombinant Full Length Human DNAJC22 Protein, GST-tagged

• Cat.No.: DNAJC22-4862HF
• Product Overview: Human FLJ13236 full-length ORF ( NP_079178.2, 1 a.a. - 341 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 341 amino acids
• Description: DNAJC22 (DnaJ Heat Shock Protein Family (Hsp40) Member C22) is a Protein Coding gene. Diseases associated with DNAJC22 include Leukoencephalopathy With Vanishing White Matter. GO annotations related to this gene include unfolded protein binding and chaperone binding.
• Molecular Mass: 64.5 kDa
• AA Sequence: MAKGLLVTYALWAVGGPAGLHHLYLGRDSHALLWMLTLGGGGLGWLWEFWKLPSFVAQANRAQGQRQSPRGVTPPLSPIRFAAQVIVGIYFGLVALISLSSMVNFYIVALPLAVGLGVLLVAAVGNQTSDFKNTLGSAFLTSPIFYGRPIAILPISVAASITAQRHRRYKALVASEPLSVRLYRLGLAYLAFTGPLAYSALCNTAATLSYVAETFGSFLNWFSFFPLLGRLMEFVLLLPYRIWRLLMGETGFNSSCFQEWAKLYEFVHSFQDEKRQLAYQVLGLSEGATNEEIHRSYQELVKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKPWGSRR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DNAJC22 DnaJ (Hsp40) homolog, subfamily C, member 22 [ Homo sapiens ]
• Official Symbol: DNAJC22
• Synonyms: DNAJC22; DnaJ (Hsp40) homolog, subfamily C, member 22; dnaJ homolog subfamily C member 22; FLJ13236; wurst homolog (Drosophila); wus; wurst homolog
• Gene ID: 79962
• mRNA Refseq: NM_024902
• Protein Refseq: NP_079178
• UniProt ID: Q8N4W6