Recombinant Full Length Human DMRTB1 Protein, GST-tagged

• Cat.No.: DMRTB1-4038HF
• Product Overview: Human DMRTB1 full-length ORF ( AAH29566.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 189 amino acids
• Description: DMRTB1 (DMRT Like Family B With Proline Rich C-Terminal 1) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and sequence-specific DNA binding. An important paralog of this gene is DMRTA2.
• Molecular Mass: 46.5 kDa
• AA Sequence: MPSLAGPPFGAEAAGSGYPGPLDLRRPMRTVPGPLFTDFVRPLNINPDRALGPEYPGGSSMHPYCPFPLGYLDAPPGVPLQQGFRHVSRSQYQGGGLVSEPGGDFQPSYYLPPPPPPLPPLPPLPPQPQFLPPGYLSALHFLPPPPPPPPPSSFSLTVLFDTDKENTDDQDAEVLSGEPSQPSSQEQSD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DMRTB1 DMRT-like family B with proline-rich C-terminal, 1 [ Homo sapiens ]
• Official Symbol: DMRTB1
• Synonyms: DMRTB1; DMRT-like family B with proline-rich C-terminal, 1; doublesex- and mab-3-related transcription factor B1
• Gene ID: 63948
• mRNA Refseq: NM_033067
• Protein Refseq: NP_149056
• MIM: 614805
• UniProt ID: Q96MA1