Recombinant Full Length Human DHRS13 Protein, GST-tagged

• Cat.No.: DHRS13-2521HF
• Product Overview: Human DHRS13 full-length ORF ( NP_653284.1, 1 a.a. - 327 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 327 amino acids
• Description: DHRS13 (Dehydrogenase/Reductase 13) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity and coenzyme binding. An important paralog of this gene is RDH12.
• Molecular Mass: 62.2 kDa
• AA Sequence: MTALELARRGARVVLACRSQERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLSSEPRLDILIHNAGISSCGRTREAFNLLLRVNHIGPFLLTHLLLPCLKACAPSRVVVVASAAHCRGRLDFKRLDRPVVGWRQELRAYADTKLANVLFARELANQLEATGVTCYAAHPGPVNSELFLRHVPGWLRPLLRPLAWLVLRAPRGGAQTPLYCALQEGIEPLSGRYFANCHVEEVPPAARDDRAAHRLWEASKRLAGLGPGEDAEPDEDPQSEDSEAPSSLSTPHPEEPTVSQPYPSPQSSPDLSKMTHRIQAKVEPEIQLS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DHRS13 dehydrogenase/reductase (SDR family) member 13 [ Homo sapiens ]
• Official Symbol: DHRS13
• Synonyms: DHRS13; dehydrogenase/reductase (SDR family) member 13; dehydrogenase/reductase SDR family member 13; MGC23280; SDR7C5; short chain dehydrogenase/reductase family 7C; member 5; short chain dehydrogenase/reductase family 7C, member 5
• Gene ID: 147015
• mRNA Refseq: NM_144683
• Protein Refseq: NP_653284
• MIM: 616157
• UniProt ID: Q6UX07