Recombinant Full Length Human DEPDC1B Protein, GST-tagged

Cat.No. : DEPDC1B-2471HF
Product Overview : Human DEPDC1B full-length ORF ( AAH10904, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 187 amino acids
Description : DEPDC1B (DEP Domain Containing 1B) is a Protein Coding gene. Among its related pathways are Signaling by GPCR and p75 NTR receptor-mediated signalling. GO annotations related to this gene include GTPase activator activity. An important paralog of this gene is DEPDC1.
Molecular Mass : 46.31 kDa
AA Sequence : MPPLCDGFGTRTLMVQTFSRCILCSKDEVDLDELLAARLVTFLMDNYQEILKVPLALQTSIEERVAHLRRVQVKYPGADMDITLSAPSFCRQISPEEFEYQRSYGSQEPLAALLEEVITDAKLSNKEKKKKLKQFQKSYPEVYQERFPTPESAALLFPEKPKPKPQLLMWALKKPFQPFQRTRSFRM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DEPDC1B DEP domain containing 1B [ Homo sapiens ]
Official Symbol DEPDC1B
Synonyms DEPDC1B; DEP domain containing 1B; DEP domain-containing protein 1B; BRCC3; breast cancer cell 3; XTP1; HBxAg transactivated protein 1; HBV XAg-transactivated protein 8; HBV X-transactivated gene 8 protein; FLJ11252;
Gene ID 55789
mRNA Refseq NM_001145208
Protein Refseq NP_001138680
MIM 616073
UniProt ID Q8WUY9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DEPDC1B Products

Required fields are marked with *

My Review for All DEPDC1B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon