Recombinant Full Length Human DEPDC1B Protein, GST-tagged

• Cat.No.: DEPDC1B-2471HF
• Product Overview: Human DEPDC1B full-length ORF ( AAH10904, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: DEPDC1B (DEP Domain Containing 1B) is a Protein Coding gene. Among its related pathways are Signaling by GPCR and p75 NTR receptor-mediated signalling. GO annotations related to this gene include GTPase activator activity. An important paralog of this gene is DEPDC1.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 46.31 kDa
• Protein length: 187 amino acids
• AA Sequence: MPPLCDGFGTRTLMVQTFSRCILCSKDEVDLDELLAARLVTFLMDNYQEILKVPLALQTSIEERVAHLRRVQVKYPGADMDITLSAPSFCRQISPEEFEYQRSYGSQEPLAALLEEVITDAKLSNKEKKKKLKQFQKSYPEVYQERFPTPESAALLFPEKPKPKPQLLMWALKKPFQPFQRTRSFRM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DEPDC1B DEP domain containing 1B [ Homo sapiens ]
• Official Symbol: DEPDC1B
• Synonyms: DEPDC1B; DEP domain containing 1B; DEP domain-containing protein 1B; BRCC3; breast cancer cell 3; XTP1; HBxAg transactivated protein 1; HBV XAg-transactivated protein 8; HBV X-transactivated gene 8 protein; FLJ11252
• Gene ID: 55789
• mRNA Refseq: NM_001145208
• Protein Refseq: NP_001138680
• MIM: 616073
• UniProt ID: Q8WUY9