Recombinant Full Length Human DEGS1 Protein, GST-tagged

• Cat.No.: DEGS1-2456HF
• Product Overview: Human DEGS1 full-length ORF ( NP_003667.1, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 323 amino acids
• Description: This gene encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor. [provided by RefSeq, Mar 2010]
• Molecular Mass: 64.3 kDa
• AA Sequence: MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVIFGAYAFGSCINHSMTLAIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPYSISFKRYHMDHHRYLGADGVDVDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPKPITYLEVINTVAQVTFDILIYYFLGIKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DEGS1 delta(4)-desaturase, sphingolipid 1 [ Homo sapiens ]
• Official Symbol: DEGS1
• Synonyms: DEGS1; delta(4)-desaturase, sphingolipid 1; degenerative spermatocyte homolog 1, lipid desaturase (Drosophila); sphingolipid delta(4)-desaturase DES1; DEGS 1; Des 1; DES1; FADS7; MLD; sphingolipid delta(4) desaturase 1; membrane lipid desaturase; dihydroceramide desaturase; sphingolipid delta 4 desaturase; migration-inducing gene 15 protein; sphingolipid delta(4)-desaturase 1; membrane fatty acid (lipid) desaturase; cell migration-inducing gene 15 protein; degenerative spermatocyte homolog, lipid desaturase; degenerative spermatocyte homolog 1, lipid desaturase; DEGS; Des-1; MIG15; DEGS-1; MGC5079
• Gene ID: 8560
• mRNA Refseq: NM_003676
• Protein Refseq: NP_003667
• MIM: 615843
• UniProt ID: O15121