Recombinant Full Length Human DDIT4L Protein, GST-tagged
Cat.No. : | DDIT4L-2452HF |
Product Overview : | Human DDIT4L full-length ORF ( NP_660287.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 193 amino acids |
Description : | DDIT4L (DNA Damage Inducible Transcript 4 Like) is a Protein Coding gene. Among its related pathways are mTOR signalling. An important paralog of this gene is DDIT4. |
Molecular Mass : | 48.1 kDa |
AA Sequence : | MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVFKQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DDIT4L DNA-damage-inducible transcript 4-like [ Homo sapiens ] |
Official Symbol | DDIT4L |
Synonyms | DDIT4L; DNA-damage-inducible transcript 4-like; DNA damage-inducible transcript 4-like protein; similar to Smhs1 protein; REDD2; regulated in development and DNA damage response 2; Rtp801L; REDD-2; homolog of mouse SMHS1; HIF-1 responsive protein RTP801-like; protein regulated in development and DNA damage response 2; |
Gene ID | 115265 |
mRNA Refseq | NM_145244 |
Protein Refseq | NP_660287 |
MIM | 607730 |
UniProt ID | Q96D03 |
◆ Recombinant Proteins | ||
DDIT4L-1812R | Recombinant Rat DDIT4L Protein | +Inquiry |
DDIT4L-1470R | Recombinant Rat DDIT4L Protein, His (Fc)-Avi-tagged | +Inquiry |
DDIT4L-7855H | Recombinant Human DDIT4L protein, GST-tagged | +Inquiry |
DDIT4L-11882H | Recombinant Human DDIT4L, GST-tagged | +Inquiry |
DDIT4L-1033R | Recombinant Rhesus Macaque DDIT4L Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDIT4L-453HCL | Recombinant Human DDIT4L cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDIT4L Products
Required fields are marked with *
My Review for All DDIT4L Products
Required fields are marked with *
0
Inquiry Basket