Recombinant Full Length Human DDIT4L Protein, GST-tagged

• Cat.No.: DDIT4L-2452HF
• Product Overview: Human DDIT4L full-length ORF ( NP_660287.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 193 amino acids
• Description: DDIT4L (DNA Damage Inducible Transcript 4 Like) is a Protein Coding gene. Among its related pathways are mTOR signalling. An important paralog of this gene is DDIT4.
• Molecular Mass: 48.1 kDa
• AA Sequence: MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVFKQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DDIT4L DNA-damage-inducible transcript 4-like [ Homo sapiens ]
• Official Symbol: DDIT4L
• Synonyms: DDIT4L; DNA-damage-inducible transcript 4-like; DNA damage-inducible transcript 4-like protein; similar to Smhs1 protein; REDD2; regulated in development and DNA damage response 2; Rtp801L; REDD-2; homolog of mouse SMHS1; HIF-1 responsive protein RTP801-like; protein regulated in development and DNA damage response 2
• Gene ID: 115265
• mRNA Refseq: NM_145244
• Protein Refseq: NP_660287
• MIM: 607730
• UniProt ID: Q96D03