Recombinant Full Length Human DDHD1 Protein, C-Flag-tagged
Cat.No. : | DDHD1-2196HFL |
Product Overview : | Recombinant Full Length Human DDHD1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the intracellular phospholipase A1 gene family. The protein encoded by this gene preferentially hydrolyzes phosphatidic acid. It is a cytosolic protein with some mitochondrial localization, and is thought to be involved in the regulation of mitochondrial dynamics. Overexpression of this gene causes fragmentation of the tubular structures in mitochondria, while depletion of the gene results in mitochondrial tubule elongation. Deletion of this gene in male mice caused fertility defects, resulting from disruption in the organization of the mitochondria during spermiogenesis. In humans, mutations in this gene have been associated with hereditary spastic paraplegia (HSP), also known as Strumpell-Lorrain disease, or, familial spastic paraparesis (FSP). This inherited disorder is characterized by progressive weakness and spasticity of the legs. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 96.9 kDa |
AA Sequence : | MNYPGRGSPRSPEHNGRGGGGGAWELGSDARPAFGGGVCCFEHLPGGDPDDGDVPLALLRGEPGLHLAPG TDDHNHHLALDPCLSDENYDFSSAESGSSLRYYSEGESGGGGSSLSLHPPQQPPLVPTNSGGGGATGGSP GERKRTRLGGPAARHRYEVVTELGPEEVRWFYKEDKKTWKPFIGYDSLRIELAFRTLLQTTGARPQGGDR DGDHVCSPTGPASSSGEDDDEDRACGFCQSTTGHEPEMVELVNIEPVCVRGGLYEVDVTQGECYPVYWNQ ADKIPVMRGQWFIDGTWQPLEEEESNLIEQEHLNCFRGQQMQENFDIEVSKSIDGKDAVHSFKLSRNHVD WHSVDEVYLYSDATTSKIARTVTQKLGFSKASSSGTRLHRGYVEEATLEDKPSQTTHIVFVVHGIGQKMD QGRIIKNTAMMREAARKIEERHFSNHATHVEFLPVEWRSKLTLDGDTVDSITPDKVRGLRDMLNSSAMDI MYYTSPLYRDELVKGLQQELNRLYSLFCSRNPDFEEKGGKVSIVSHSLGCVITYDIMTGWNPVRLYEQLL QKEEELPDERWMSYEERHLLDELYITKRRLKEIEERLHGLKASSMTQTPALKFKVENFFCMGSPLAVFLA LRGIRPGNTGSQDHILPREICNRLLNIFHPTDPVAYRLEPLILKRYSNISPVQIHWYNTSNPLPYEHMKP SFLNPAKEPTSVSENEGISTIPSPVTSPVLSRRHYGESITNIGKASILGAASIGKGLGGMLFSRFGRSST TQSSETSKDSMEDEKKPVASPSATTVGTQTLPHSSSGFLDSALELDHRIDFELREGLVESRYWSAVTSHT AYWSSLDVALFLLTFMYKHEHDDDAKPNLDPI myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | DDHD1 DDHD domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | DDHD1 |
Synonyms | SPG28; PAPLA1; iPLA1I; PA-PLA1; iPLA1alpha |
Gene ID | 80821 |
mRNA Refseq | NM_030637.3 |
Protein Refseq | NP_085140.2 |
MIM | 614603 |
UniProt ID | Q8NEL9 |
◆ Recombinant Proteins | ||
DDHD1-229H | Recombinant Human DDHD1 Protein, MYC/DDK-tagged | +Inquiry |
DDHD1-2705H | Recombinant Human DDHD1 protein, His-tagged | +Inquiry |
DDHD1-4057H | Recombinant Human DDHD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DDHD1-732H | Recombinant Human DDHD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ddhd1-533M | Recombinant Mouse Ddhd1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDHD1-7028HCL | Recombinant Human DDHD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDHD1 Products
Required fields are marked with *
My Review for All DDHD1 Products
Required fields are marked with *
0
Inquiry Basket