Recombinant Full Length Human DCBLD2 Protein, GST-tagged

• Cat.No.: DCBLD2-2796HF
• Product Overview: Human DCBLD2 full-length ORF ( NP_563615.3, 1 a.a. - 775 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 775 amino acids
• Description: DCBLD2 (Discoidin, CUB And LCCL Domain Containing 2) is a Protein Coding gene. Diseases associated with DCBLD2 include X-Linked Nonsyndromic Deafness and Diverticulitis. Among its related pathways are Neuroscience. An important paralog of this gene is DCBLD1.
• Molecular Mass: 111.4 kDa
• AA Sequence: MASRAVVRARRCPQCPQVRAAAAAPAWAALPLSRSLPPCSNSSSFSMPLFLLLLLVLLLLLEDAGAQQGDGCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNEITLLFMSGIHVSGRGFLASYSVIDKQDLITCLDTASNFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLGMESGVIADPQITASSVLEWTDHTGQENSWKPKKARLKKPGPPWAAFATDEYQWLQIDLNKEKKITGIITTGSTMVEHNYYVSAYRILYSDDGQKWTVYREPGVEQDKIFQGNKDYHQDVRNNFLPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRNSNDLKNTTAPPKIAKGRAPKFTQPLQPRSSNEFPAQTEQTTASPDIRNTTVTPNVTKDVALAAVLVPVLVMVLTTLILILVCAWHWRNRKKKTEGTYDLPYWDRAGWWKGMKQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPSTSTFKATGNQPPPLVGTYNTLLSRTDSCSSAQAQYDTPKAGKPGLPAPDELVYQVPQSTQEVSGAGRDGECDVFKEIL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DCBLD2 discoidin, CUB and LCCL domain containing 2 [ Homo sapiens ]
• Official Symbol: DCBLD2
• Synonyms: DCBLD2; discoidin, CUB and LCCL domain containing 2; discoidin, CUB and LCCL domain-containing protein 2; CLCP1; ESDN; 1700055P21Rik; coagulation factor V/VIII-homology domains protein 1; CUB, LCCL and coagulation factor V/VIII-homology domains protein 1; endothelial and smooth muscle cell-derived neuropilin-like protein
• Gene ID: 131566
• mRNA Refseq: NM_080927
• Protein Refseq: NP_563615
• MIM: 608698
• UniProt ID: Q96PD2