Recombinant Full Length Human DCBLD2 Protein, GST-tagged
Cat.No. : | DCBLD2-2796HF |
Product Overview : | Human DCBLD2 full-length ORF ( NP_563615.3, 1 a.a. - 775 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 775 amino acids |
Description : | DCBLD2 (Discoidin, CUB And LCCL Domain Containing 2) is a Protein Coding gene. Diseases associated with DCBLD2 include X-Linked Nonsyndromic Deafness and Diverticulitis. Among its related pathways are Neuroscience. An important paralog of this gene is DCBLD1. |
Molecular Mass : | 111.4 kDa |
AA Sequence : | MASRAVVRARRCPQCPQVRAAAAAPAWAALPLSRSLPPCSNSSSFSMPLFLLLLLVLLLLLEDAGAQQGDGCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNEITLLFMSGIHVSGRGFLASYSVIDKQDLITCLDTASNFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLGMESGVIADPQITASSVLEWTDHTGQENSWKPKKARLKKPGPPWAAFATDEYQWLQIDLNKEKKITGIITTGSTMVEHNYYVSAYRILYSDDGQKWTVYREPGVEQDKIFQGNKDYHQDVRNNFLPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRNSNDLKNTTAPPKIAKGRAPKFTQPLQPRSSNEFPAQTEQTTASPDIRNTTVTPNVTKDVALAAVLVPVLVMVLTTLILILVCAWHWRNRKKKTEGTYDLPYWDRAGWWKGMKQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPSTSTFKATGNQPPPLVGTYNTLLSRTDSCSSAQAQYDTPKAGKPGLPAPDELVYQVPQSTQEVSGAGRDGECDVFKEIL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DCBLD2 discoidin, CUB and LCCL domain containing 2 [ Homo sapiens ] |
Official Symbol | DCBLD2 |
Synonyms | DCBLD2; discoidin, CUB and LCCL domain containing 2; discoidin, CUB and LCCL domain-containing protein 2; CLCP1; ESDN; 1700055P21Rik; coagulation factor V/VIII-homology domains protein 1; CUB, LCCL and coagulation factor V/VIII-homology domains protein 1; endothelial and smooth muscle cell-derived neuropilin-like protein; |
Gene ID | 131566 |
mRNA Refseq | NM_080927 |
Protein Refseq | NP_563615 |
MIM | 608698 |
UniProt ID | Q96PD2 |
◆ Recombinant Proteins | ||
DCBLD2-5030Z | Recombinant Zebrafish DCBLD2 | +Inquiry |
DCBLD2-2188H | Recombinant Human DCBLD2 protein, His-tagged | +Inquiry |
DCBLD2-1790R | Recombinant Rat DCBLD2 Protein | +Inquiry |
DCBLD2-2385H | Recombinant Human DCBLD2 Protein, GST-tagged | +Inquiry |
DCBLD2-2226M | Recombinant Mouse DCBLD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCBLD2-868HCL | Recombinant Human DCBLD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DCBLD2 Products
Required fields are marked with *
My Review for All DCBLD2 Products
Required fields are marked with *
0
Inquiry Basket