Recombinant Full Length Human DCANP1 Protein, GST-tagged

Cat.No. : DCANP1-2659HF
Product Overview : Human DCANP1 full-length ORF (NP_570900.1, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
ProteinLength : 244 amino acids
Description : This intronless gene is specifically expressed in dendritic cells (DCs), which are potent antigen-presenting cells involved in activating naive T cells to initiate antigen-specific immune response. The encoded protein is localized mainly in the perinucleus. One of the alleles (A/T) of this gene, that causes premature translation termination at aa 117, has been associated with an increased prevalence of major depression in humans. [provided by RefSeq, Jul 2008]
Molecular Mass : 53.1 kDa
AA Sequence : MHYGAATHIQNSRSHGLETVPGHQRLERGAGGETPEFPGCHSPAPPENFGNELLPLSAPLQGLSEGLYPPGRNKTLPAGVLREGAVQFLHRGLCNSNLSSEASARPSGTQDELHSSRRKTGQTRREGARKHLVCSFRLYPFTVHTVSPGNSHLALYQVFKAVKLCPSETSFFLSRKSLKSSDPWHPPSLSPNSWNRQAGFRAWSSHLISLSLTCSDSQSRRVSSSQQPPLHSLSSHRRAAHVPE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DCANP1 dendritic cell associated nuclear protein [ Homo sapiens (human) ]
Official Symbol DCANP1
Synonyms DCANP1; dendritic cell associated nuclear protein; C5ORF20; chromosome 5 open reading frame 20; dendritic cell nuclear protein 1; DCNP1;
Gene ID 140947
mRNA Refseq NM_130848
Protein Refseq NP_570900
MIM 609710
UniProt ID Q8TF63

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DCANP1 Products

Required fields are marked with *

My Review for All DCANP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon