Recombinant Full Length Human DAD1 Protein, GST-tagged

• Cat.No.: DAD1-2314HF
• Product Overview: Human DAD1 full-length ORF ( AAH07403, 1 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: DAD1, the defender against apoptotic cell death, was initially identified as a negative regulator of programmed cell death in the temperature sensitive tsBN7 cell line. The DAD1 protein disappeared in temperature-sensitive cells following a shift to the nonpermissive temperature, suggesting that loss of the DAD1 protein triggered apoptosis. DAD1 is believed to be a tightly associated subunit of oligosaccharyltransferase both in the intact membrane and in the purified enzyme, thus reflecting the essential nature of N-linked glycosylation in eukaryotes. [provided by RefSeq, Jul 2008]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 38.17 kDa
• Protein length: 113 amino acids
• AA Sequence: MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DAD1 defender against cell death 1 [ Homo sapiens ]
• Official Symbol: DAD1
• Synonyms: DAD1; defender against cell death 1; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; oligosaccharyltransferase 2 homolog (S. cerevisiae); OST2; DAD-1; oligosaccharyltransferase 2 homolog; oligosaccharyl transferase subunit DAD1
• Gene ID: 1603
• mRNA Refseq: NM_001344
• Protein Refseq: NP_001335
• MIM: 600243
• UniProt ID: P61803